blackfeet.mpqhf.comA guide to the organizations and events of the Blackfeet Reservation

blackfeet.mpqhf.com Profile

Blackfeet.mpqhf.com is a subdomain of mpqhf.com, which was created on 2007-01-26,making it 18 years ago. It has several subdomains, such as fortbelknap.mpqhf.com , among others.

Discover blackfeet.mpqhf.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

blackfeet.mpqhf.com Information

HomePage size: 75.42 KB
Page Load Time: 0.44184 Seconds
Website IP Address: 104.207.254.57

blackfeet.mpqhf.com Similar Website

CTUIR GIS Program
gis.ctuir.org
Education Events | Health Events | Smart City Events
events.eletsonline.com
Booking a Reservation - Expressway Airport Parking
reservations.expresswayparking.com
WordPress Hotel Booking Plugin Demo – Reservation System
hbdemo.getmotopress.com
Calendar of Allergy Asthma Network Events | Webinars, In-Person Events, Virtual Events, and NOML Eve
calendar.allergyasthmanetwork.org
Upcoming Events in Moreno Valley, CA (92555) | Press Enterprise Events - Events – Press Enterprise
event.pe.com
New Mexico Events Calendar, Albuquerque Events Calendar, Santa Fe Events Calendar | KOB.com
events.kob.com
New Reservation - DCoL Events & Room Reservations - Durham County Library
rooms.durhamcountylibrary.org
A guide to the organizations and events of the Fort Belknap Reservation
fortbelknap.mpqhf.com
Bowdoin Student Organizations | web hosting for student organizations
students.bowdoin.edu
Student Events, Clubs and Organizations | Student Activities, Involvement, and Leadership | Providen
student-activities.providence.edu
AB Events - American Bazaar Events Venture Capitals, Startup Events, Investment Forum, Philanthropy
abevents.americanbazaaronline.com
Live! 360 Events Home: 6 Great Events, 1 Low Price! -- Live! 360 Events
www2.live360events.com
Welcome to Wansport.com – David Ensignia Tennis Academy – Online reservation and sports centers
davidensigniatennisacademy.wansport.com

blackfeet.mpqhf.com Httpheader

Server: nginx
Date: Mon, 13 May 2024 16:50:59 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Pragma: no-cache
Link: https://blackfeet.mpqhf.com/; rel=shortlink
X-Cache-NxAccel: BYPASS

blackfeet.mpqhf.com Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1" name="viewport"/
content="max-image-preview:large" name="robots"
content="WordPress 6.5.3" name="generator"

blackfeet.mpqhf.com Ip Information

Ip Country: United States
Latitude: 37.751
Longitude: -97.822

blackfeet.mpqhf.com Html To Plain Text

Home Community Resources Events Event Map Definitions User Tips Scroll down to content Welcome Blackfeet Connections About the Blackfeet People The Blackfeet people, also known as the Ampskapi Pikuni band of the Blackfoot Confederacy, have occupied the Northern Plains and the Rocky Mountain regions for more than 10,000 years. There are four Blackfeet bands – the North Piegan, the South Piegan, the Blood and the Siksika. In the 18th and 19th centuries the bands occupied much of the Northern Plains and they were nomadic, following the seasonal grazing and migration of the buffalo. The Ampskapi Pikuni band of the Blackfoot Confederacy is the only band located in the United States. There are more than 17,000 members of the Blackfeet tribe and it is one of the largest tribes in the United States. About the Blackfeet Reservation The Blackfeet Reservation is located in Montana along the Rocky Mountain Front, where the Northern Plains meet the Rocky Mountains. The reservation boarders Glacier National Park to the west and consists of nearly 1.5 million acres of land. The land is still used for cultural and spiritual purposes to this day. The town of Browning is the hub for the Blackfeet Reservation. About the Blackfeet Government The governing body for the Blackfeet is called the Blackfeet Tribal Business Council (BTBC). It consists of nine Tribal Council Members. The BTBC handles all tribal business for enrolled members of the tribe. There are four districts that divide the reservation. For more information visit http://blackfeetnation.com/government/ . About this Interactive Map The purpose of this map is to provide resources, locations and information for the Blackfeet people in an easy-to-use format. Mountain-Pacific Quality Health (Mountain-Pacific) created this map through the Partnership to Advance Tribal Health (PATH) project. One goal of the PATH project is to improve health for American Indians and Alaska Natives by improving the quality of care though the implementation of best practices and the identification of operational improvement needs. Mountain-Pacific is the federally designated Quality Innovation Network-Quality Improvement Organization (QIN-QIO) for the state of Montana and is leading the PATH work in the state in partnership with HealthInsight, a QIN-QIO. This three-year initiative is funded by the Centers for Medicare & Medicaid Services (CMS). Developed by Mountain-Pacific Quality Health, the Medicare Quality Innovation Network-Quality Improvement Organization (QIN-QIO) for Montana, Wyoming, Alaska, Hawaii and the U.S. Pacific Territories of Guam and American Samoa and the Commonwealth of the Northern Mariana Islands, under contract with the Centers for Medicare & Medicaid Services (CMS), an agency of the U.S. Department of Health and Human Services. Contents presented do not necessarily reflect CMS policy. *Photo courtesy Parker Wood Proudly powered by...

blackfeet.mpqhf.com Whois

Domain Name: MPQHF.COM Registry Domain ID: 777987858_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.ionos.com Registrar URL: http://www.ionos.com Updated Date: 2024-01-27T08:48:26Z Creation Date: 2007-01-26T22:18:03Z Registry Expiry Date: 2025-01-26T22:18:03Z Registrar: IONOS SE Registrar IANA ID: 83 Registrar Abuse Contact Email: abuse@ionos.com Registrar Abuse Contact Phone: +1.6105601459 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1087.UI-DNS.BIZ Name Server: NS1087.UI-DNS.COM Name Server: NS1087.UI-DNS.DE Name Server: NS1087.UI-DNS.ORG DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T20:13:57Z <<<